PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00015g12028.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family EIL
Protein Properties Length: 393aa    MW: 45496.2 Da    PI: 4.6369
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00015g12028.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3244.94.4e-75302071185
                               XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                      EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpve 85 
                               ++lkkrmwkd+m+l++lk + +++  +k++++++   +  +eq+r+kkmsraQD+iLkYM+k+mevc+ qGfvYgi+pekgkpv+
  Peinf101Scf00015g12028.1  30 DDLKKRMWKDRMKLQKLKAKGESSSTSKDPQADEV--QAKEEQSRQKKMSRAQDSILKYMVKIMEVCEGQGFVYGIVPEKGKPVS 112
                               79*********************999999966665..6899******************************************** PP

                               XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HH CS
                      EIN3  86 gasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvep 170
                               g+sdsLr+WWkekv+f++ +paai++    +l+     +  ++++s  ++l+el D+tl+ LLs+lmqhcdppqr+fple+g++p
  Peinf101Scf00015g12028.1 113 GSSDSLREWWKEKVRFEQSAPAAIAEF-LPKLVE----ETIMDATSHINRLEELRDSTLSTLLSTLMQHCDPPQRSFPLERGLAP 192
                               *************************99.445553....34456799*************************************** PP

                               HH---S--HHHHHHT CS
                      EIN3 171 PWWPtGkelwwgelg 185
                               PWWPtGkelww+e g
  Peinf101Scf00015g12028.1 193 PWWPTGKELWWEEEG 207
                               ************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048739.6E-8030208No hitNo description
Gene3DG3DSA:1.10.3180.102.7E-25152210IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.66E-24157215IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MVEFHEINEP LSPMAEFFEF EEDQEDISYD DLKKRMWKDR MKLQKLKAKG ESSSTSKDPQ  60
ADEVQAKEEQ SRQKKMSRAQ DSILKYMVKI MEVCEGQGFV YGIVPEKGKP VSGSSDSLRE  120
WWKEKVRFEQ SAPAAIAEFL PKLVEETIMD ATSHINRLEE LRDSTLSTLL STLMQHCDPP  180
QRSFPLERGL APPWWPTGKE LWWEEEGKEY LALVPKNVNV FDSSVLRKND KRKCNFEREI  240
TTEDVLYPCQ NSNCPQSGLS FGFLDKNTRI EHETSCSYRE NGGLNNQENI KTEDQFEMSI  300
NKFPGLNIEA QMLSREEWIA RGEIAPQYLM NIKIRRSFNN YHAQIADGGK ILKYFESYMG  360
DDVLEQLLCD QTTYGNMNLK ETPSEDVLNQ EAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_B1e-19153207155Protein ETHYLENE INSENSITIVE 3
4zds_A1e-19153207155Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-120HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015162960.11e-136PREDICTED: putative ETHYLENE INSENSITIVE 3-like 4 protein
SwissprotQ9FJQ51e-71EIL5_ARATH; ETHYLENE INSENSITIVE 3-like 5 protein
TrEMBLK4BJ811e-132K4BJ81_SOLLC; Uncharacterized protein
STRINGSolyc03g096630.1.11e-131(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65100.11e-60EIL family protein